Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
beardski.nl 2025-03-28 00:00 Place bid
psychedelen.nl 2025-03-16 00:00 Place bid
campusazur.eu 2025-04-08 00:00 Place bid
vcontent.nl 2025-03-29 00:00 Place bid
yesparking.be 2025-03-11 00:00 Place bid
buddyclub.nl 2025-04-11 00:00 Place bid
dhzdomotica.nl 2025-03-09 00:00 Place bid
hyoutube.nl 2025-03-20 00:00 Place bid
deknapstefamilievannederland.nl 2025-03-05 00:00 Place bid
pianoscore.nl 2025-03-06 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

71832

.NL Domain names

15355

.BE Domain names

56988

.EU Domain names