Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
sneaknacht.nl 2025-07-10 00:00 Place bid
azdemat.be 2025-07-21 00:00 Place bid
futureskills.be 2025-07-20 00:00 Place bid
kefo.eu 2025-08-05 00:00 Place bid
eu-app16.eu 2025-07-24 00:00 Place bid
beitsvoordelig.nl 2025-08-05 00:00 Place bid
energiedeskundige-peeters.be 2025-08-11 00:00 Place bid
tastyfriedchickenamstelveen-amstelveen.nl 2025-08-05 00:00 Place bid
drachtsterlyceum.nl 2025-08-07 00:00 Place bid
bimnetwerk.nl 2025-07-25 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

71064

.NL Domain names

14331

.BE Domain names

49633

.EU Domain names