Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
dealfind.eu 2026-09-06 00:00 Place bid
vanhaastrechtscheepstimmerwerk.nl 2026-08-11 00:00 Place bid
kidscraft.eu 2026-09-07 00:00 Place bid
startoffice365.nl 2026-08-18 00:00 Place bid
inscio-roofs.be 2026-08-17 00:00 Place bid
resetmedia.eu 2026-09-06 00:00 Place bid
islamicum.eu 2026-08-29 00:00 Place bid
alabraar.eu 2026-09-12 00:00 Place bid
experiencetaylormade.eu 2026-08-23 00:00 Place bid
homosexslaaf.nl 2026-08-09 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

55869

.NL Domain names

14546

.BE Domain names

57034

.EU Domain names