Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
deknapstefamilievannederland.nl 2025-03-05 00:00 Place bid
beweegopjewerkdag.nl 2025-03-28 00:00 Place bid
eldescent.eu 2025-04-05 00:00 Place bid
mijn-energieadvies.nl 2025-03-23 00:00 Place bid
unihome.nl 2025-04-01 00:00 Place bid
vrmeet.eu 2025-03-29 00:00 Place bid
ericatoernooi.nl 2025-04-12 00:00 Place bid
puur-coachingentraining.nl 2025-03-17 00:00 Place bid
ssdshop.be 2025-03-10 00:00 Place bid
dierenklinieknuland.nl 2025-03-14 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

70873

.NL Domain names

16364

.BE Domain names

57038

.EU Domain names