Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
wijsomarmt.nl 2025-07-19 00:00 Place bid
giftbag.eu 2025-07-14 00:00 Place bid
format-4.eu 2025-07-29 00:00 Place bid
websecuritynl.nl 2025-08-03 00:00 Place bid
tastyfriedchickenamstelveen-amstelveen.nl 2025-08-05 00:00 Place bid
pcic.eu 2025-07-22 00:00 Place bid
ticketaanbod.nl 2025-07-20 00:00 Place bid
litauto.eu 2025-07-22 00:00 Place bid
alettadevoedingscoach.nl 2025-07-29 00:00 Place bid
zpcnajade.nl 2025-08-14 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

74611

.NL Domain names

10098

.BE Domain names

47756

.EU Domain names