Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
ferronnerieschillings.be 2026-08-11 00:00 Place bid
vanhaastrechtscheepstimmerwerk.nl 2026-08-11 00:00 Place bid
ocasforzesca.eu 2026-09-09 00:00 Place bid
hertalan-epdm.eu 2026-08-13 00:00 Place bid
megaduel.eu 2026-08-13 00:00 Place bid
thangkatattoo.nl 2026-09-05 00:00 Place bid
gs-capital.eu 2026-08-18 00:00 Place bid
stedentriptrein.nl 2026-08-30 00:00 Place bid
saint-james-way.eu 2026-09-13 00:00 Place bid
bulgarianapartment.eu 2026-09-07 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

54138

.NL Domain names

14106

.BE Domain names

56244

.EU Domain names