Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
thecove.be 2025-08-10 00:00 Place bid
snorscooter-verzekering.nl 2025-08-08 00:00 Place bid
tastyfriedchickenamstelveen-amstelveen.nl 2025-08-05 00:00 Place bid
ayintap-kebap-uden.nl 2025-07-18 00:00 Place bid
handmadeinfryslan.nl 2025-08-09 00:00 Place bid
campingdestriene.nl 2025-08-15 00:00 Place bid
momentivetogether.eu 2025-07-14 00:00 Place bid
megaenministars.nl 2025-07-12 00:00 Place bid
meatandmorestore.nl 2025-07-11 00:00 Place bid
fieldpro.nl 2025-07-18 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

73266

.NL Domain names

15312

.BE Domain names

52518

.EU Domain names