Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
ads365.eu 2025-08-13 00:00 Place bid
darkskyhotel.nl 2025-08-06 00:00 Place bid
breadandmoremaastricht.nl 2025-07-17 00:00 Place bid
mk-montage.eu 2025-08-06 00:00 Place bid
fysiovanbekrel.nl 2025-07-16 00:00 Place bid
cekure.nl 2025-07-28 00:00 Place bid
mountainyoga.eu 2025-07-18 00:00 Place bid
socialsolutionz.nl 2025-08-09 00:00 Place bid
tastyfriedchickenamstelveen-amstelveen.nl 2025-08-05 00:00 Place bid
aneng.nl 2025-07-22 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

74304

.NL Domain names

9408

.BE Domain names

47519

.EU Domain names