Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
galeriedenatris.nl 2024-12-24 00:00 Place bid
passionpicks.nl 2024-12-01 00:00 Place bid
debestemakelaarvanwestfriesland.nl 2024-12-01 00:00 Place bid
delibar.nl 2024-12-20 00:00 Place bid
littlevintage.nl 2024-12-10 00:00 Place bid
atelierriakuipers.nl 2024-12-18 00:00 Place bid
gecu.eu 2024-11-25 00:00 Place bid
remedial-teaching-bliss.nl 2024-12-15 00:00 Place bid
jouwmasseur.nl 2024-12-27 00:00 Place bid
ovimarket.eu 2024-12-23 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

66023

.NL Domain names

9883

.BE Domain names

46593

.EU Domain names