Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name	Auction ends at
l0g1n.eu	2025-08-18 00:00	Place bid
botbuddies.nl	2025-08-10 00:00	Place bid
golfin.nl	2025-08-14 00:00	Place bid
felixdieisjarigendatvierenwij.nl	2025-08-09 00:00	Place bid
beddenapp.nl	2025-07-22 00:00	Place bid
jeweha.nl	2025-07-22 00:00	Place bid
tastyfriedchickenamstelveen-amstelveen.nl	2025-08-05 00:00	Place bid
microsofttrainingen.nl	2025-08-19 00:00	Place bid
bonoov.eu	2025-08-20 00:00	Place bid
kapitalbank.eu	2025-08-09 00:00	Place bid

All domains that are quarantined