Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
nespressokorting.nl 2025-07-27 00:00 Place bid
consultboost.nl 2025-07-21 00:00 Place bid
traversedeconfiguration.eu 2025-07-15 00:00 Place bid
dipit.eu 2025-08-03 00:00 Place bid
tastyfriedchickenamstelveen-amstelveen.nl 2025-08-05 00:00 Place bid
stripart.nl 2025-07-24 00:00 Place bid
bushuis.nl 2025-08-02 00:00 Place bid
blouwverduurzaming.nl 2025-08-09 00:00 Place bid
uloz.eu 2025-07-16 00:00 Place bid
madevo.nl 2025-08-09 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

75294

.NL Domain names

9713

.BE Domain names

48052

.EU Domain names