Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
goodgrounding.eu 2025-03-24 00:00 Place bid
dorpsoverleghelden.nl 2025-03-05 00:00 Place bid
deknapstefamilievannederland.nl 2025-03-05 00:00 Place bid
debattour.nl 2025-03-03 00:00 Place bid
zaancup.nl 2025-02-26 00:00 Place bid
basco-portal.nl 2025-03-22 00:00 Place bid
jantrepeneur.nl 2025-03-11 00:00 Place bid
slimenergiesystemen.nl 2025-03-01 00:00 Place bid
dekeukenzaken.nl 2025-03-18 00:00 Place bid
saniloods.nl 2025-03-20 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

68554

.NL Domain names

12902

.BE Domain names

57158

.EU Domain names