Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
echtemeisjesindejungle.nl 2025-02-11 00:00 Place bid
rotbeesten.nl 2025-03-05 00:00 Place bid
main-a-main.be 2025-02-08 00:00 Place bid
ptd-group.eu 2025-02-11 00:00 Place bid
sdce.eu 2025-02-25 00:00 Place bid
deknapstefamilievannederland.nl 2025-03-05 00:00 Place bid
agroforeste.eu 2025-02-06 00:00 Place bid
nolimitt.be 2025-02-05 00:00 Place bid
creatiefintuinen.nl 2025-02-18 00:00 Place bid
496837.nl 2025-02-20 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

77893

.NL Domain names

10088

.BE Domain names

46624

.EU Domain names