Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
opruim-coach.nl 2025-07-21 00:00 Place bid
tastyfriedchickenamstelveen-amstelveen.nl 2025-08-05 00:00 Place bid
maison-sport-sante.be 2025-08-09 00:00 Place bid
gietesbos.be 2025-07-17 00:00 Place bid
shotspot.eu 2025-08-02 00:00 Place bid
amegroup.eu 2025-08-07 00:00 Place bid
gaptekmilitary.eu 2025-07-29 00:00 Place bid
equallxclub.nl 2025-08-04 00:00 Place bid
verklapt.nl 2025-07-28 00:00 Place bid
mesprogrammes.eu 2025-08-01 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

74434

.NL Domain names

9433

.BE Domain names

47615

.EU Domain names