Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
vanhaastrechtscheepstimmerwerk.nl 2026-08-11 00:00 Place bid
saradeesign.nl 2026-08-14 00:00 Place bid
resonanz-medizin.eu 2026-09-03 00:00 Place bid
appledoctor.eu 2026-08-31 00:00 Place bid
topmarket.be 2026-08-10 00:00 Place bid
bijbaantjehilversum.nl 2026-08-07 00:00 Place bid
brandingtotaal.nl 2026-08-17 00:00 Place bid
frissekijkcoaching.nl 2026-08-17 00:00 Place bid
hrgroep.eu 2026-08-08 00:00 Place bid
pitchpro.nl 2026-07-29 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

58339

.NL Domain names

10958

.BE Domain names

39917

.EU Domain names