Welcome to the Quarantined expired domains auction.
In this overview, you will find all the domains that are about to expire.
Here, you can easily bid on any preferred domain of your choice.
Register a free account, to start purchasing your favorite expired domain today.
All domains that are quarantined
Register a free account, to start purchasing your favorite expired domain today.
Quarantined domains
| Domain name | Auction ends at | |
|---|---|---|
| bierre.eu | 2024-11-22 00:00 | Place bid |
| megadebrid.eu | 2024-12-11 00:00 | Place bid |
| debestemakelaarvanwestfriesland.nl | 2024-12-01 00:00 | Place bid |
| deairconditioningspecialist.be | 2024-11-24 00:00 | Place bid |
| rnews.eu | 2024-12-15 00:00 | Place bid |
| merchonline.be | 2024-12-10 00:00 | Place bid |
| pozyczalnia.eu | 2024-11-24 00:00 | Place bid |
| imif.eu | 2024-11-25 00:00 | Place bid |
| solitair.eu | 2024-12-28 00:00 | Place bid |
| solemn.be | 2024-11-23 00:00 | Place bid |
All domains that are quarantined
Buy domain name?
Create a free account.
Find a domain you like.
Make an offer, no cure no pay.
The highest bidder wins!
Create a free account.