Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
x2design.eu 2025-02-18 00:00 Place bid
microcement-unie.nl 2025-02-16 00:00 Place bid
bosnia-hercegovina.eu 2025-02-27 00:00 Place bid
gustco.eu 2025-02-11 00:00 Place bid
skidresor-till-alperna.eu 2025-03-06 00:00 Place bid
deknapstefamilievannederland.nl 2025-03-05 00:00 Place bid
tagesangebote24.eu 2025-03-10 00:00 Place bid
zeewoldeleeft.nl 2025-03-02 00:00 Place bid
bjwcoaching.nl 2025-02-19 00:00 Place bid
dresdner-bilderwelt.eu 2025-02-26 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

85317

.NL Domain names

15666

.BE Domain names

52644

.EU Domain names