Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name	Auction ends at
deknapstefamilievannederland.nl	2025-03-05 00:00	Place bid
dekoosjerehamvraag.nl	2025-02-23 00:00	Place bid
pengar.eu	2025-02-13 00:00	Place bid
glasulbasarabiei.eu	2025-02-02 00:00	Place bid
ndc-online.nl	2025-02-16 00:00	Place bid
adtec-rf.eu	2025-02-11 00:00	Place bid
milovice.eu	2025-02-04 00:00	Place bid
tempurmatrassen.nl	2025-02-19 00:00	Place bid
global-s.eu	2025-03-06 00:00	Place bid
thegreenpill.nl	2025-02-13 00:00	Place bid

All domains that are quarantined