Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name	Auction ends at
mixtelematics.eu	2026-09-15 00:00	Place bid
kaarsenspecialist.nl	2026-08-18 00:00	Place bid
smartlynx.eu	2026-08-31 00:00	Place bid
bitcoinbar.be	2026-08-29 00:00	Place bid
businesslawyer.nl	2026-08-27 00:00	Place bid
whatsappwebcare.nl	2026-09-15 00:00	Place bid
vanhaastrechtscheepstimmerwerk.nl	2026-08-11 00:00	Place bid
theinfotainmentsite.eu	2026-09-08 00:00	Place bid
helixsolutions.eu	2026-08-26 00:00	Place bid
mymp3.eu	2026-09-11 00:00	Place bid

All domains that are quarantined