Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
zonnestudio-daphne.be 2025-02-10 00:00 Place bid
inmobiliariagranada.eu 2025-01-29 00:00 Place bid
diemcoin.eu 2025-02-19 00:00 Place bid
kunstopbestelling.nl 2025-02-21 00:00 Place bid
groepsuitjeingiethoorn.nl 2025-02-10 00:00 Place bid
podozorg-heteren.nl 2025-02-27 00:00 Place bid
deknapstefamilievannederland.nl 2025-03-05 00:00 Place bid
pokemonkaartenverkoop.nl 2025-02-05 00:00 Place bid
groupone-test-migrations1.nl 2025-02-19 00:00 Place bid
kleding4all.nl 2025-02-25 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

78513

.NL Domain names

9847

.BE Domain names

45724

.EU Domain names