Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
teamproject.eu 2026-07-29 00:00 Place bid
vanhaastrechtscheepstimmerwerk.nl 2026-08-11 00:00 Place bid
deepshare.nl 2026-08-15 00:00 Place bid
mywithings.eu 2026-08-12 00:00 Place bid
made-by-marian.nl 2026-07-20 00:00 Place bid
sfcko.eu 2026-08-11 00:00 Place bid
demassagepraktijkblaricum.nl 2026-08-15 00:00 Place bid
lown.eu 2026-07-19 00:00 Place bid
familienbett-shop.eu 2026-07-24 00:00 Place bid
oxyclub.nl 2026-07-30 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

57443

.NL Domain names

10421

.BE Domain names

33684

.EU Domain names