Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
urbanparkcity.nl 2025-07-09 00:00 Place bid
kitchenx.eu 2025-08-09 00:00 Place bid
mdfvensterbank.nl 2025-07-08 00:00 Place bid
deolijfgaarden.nl 2025-07-29 00:00 Place bid
topictwerkgevers.eu 2025-08-09 00:00 Place bid
rafallewandowski.eu 2025-07-08 00:00 Place bid
koffiefilterexperts.nl 2025-07-13 00:00 Place bid
coach25.nl 2025-07-23 00:00 Place bid
tastyfriedchickenamstelveen-amstelveen.nl 2025-08-05 00:00 Place bid
npos.be 2025-08-09 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

72322

.NL Domain names

14867

.BE Domain names

49023

.EU Domain names