Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
domaindomain.nl 2026-08-29 00:00 Place bid
leonvandermeij.nl 2026-09-08 00:00 Place bid
unifii.eu 2026-09-12 00:00 Place bid
vanhaastrechtscheepstimmerwerk.nl 2026-08-11 00:00 Place bid
midstar.nl 2026-09-01 00:00 Place bid
rayzer.eu 2026-09-06 00:00 Place bid
velstruden.eu 2026-08-11 00:00 Place bid
naturlinesex.eu 2026-09-15 00:00 Place bid
sjaals-online.nl 2026-08-28 00:00 Place bid
checklister.eu 2026-08-19 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

54457

.NL Domain names

14227

.BE Domain names

56397

.EU Domain names