Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
joel-pedicure.nl 2024-12-06 00:00 Place bid
playly.nl 2024-12-19 00:00 Place bid
dancelux.nl 2024-12-18 00:00 Place bid
altenew.nl 2024-12-17 00:00 Place bid
kayte56.eu 2024-11-30 00:00 Place bid
oderso.eu 2024-12-20 00:00 Place bid
debruidschat.nl 2024-12-10 00:00 Place bid
schermpjestuk.eu 2024-11-29 00:00 Place bid
hypothekenhome.nl 2024-11-26 00:00 Place bid
debestemakelaarvanwestfriesland.nl 2024-12-01 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

67263

.NL Domain names

10037

.BE Domain names

43272

.EU Domain names