Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name	Auction ends at
thehero.nl	2025-03-31 00:00	Place bid
deknapstefamilievannederland.nl	2025-03-05 00:00	Place bid
home-appliance.eu	2025-03-29 00:00	Place bid
limonta.eu	2025-03-07 00:00	Place bid
onlinemotorkopen.nl	2025-02-28 00:00	Place bid
jpower.eu	2025-02-24 00:00	Place bid
geschiedenisbrugge.be	2025-03-10 00:00	Place bid
xescort.nl	2025-03-21 00:00	Place bid
mozly.eu	2025-03-20 00:00	Place bid
noaromeedesign.nl	2025-03-07 00:00	Place bid

All domains that are quarantined