Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
envol-architecture.be 2026-08-11 00:00 Place bid
justtakeaway.nl 2026-08-11 00:00 Place bid
91381.eu 2026-08-08 00:00 Place bid
busyhands.nl 2026-08-19 00:00 Place bid
imacx.be 2026-08-08 00:00 Place bid
andiz.be 2026-08-11 00:00 Place bid
tegg.eu 2026-08-05 00:00 Place bid
vanhaastrechtscheepstimmerwerk.nl 2026-08-11 00:00 Place bid
opbresjes.nl 2026-08-16 00:00 Place bid
euroamericanachart.nl 2026-08-27 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

57188

.NL Domain names

14315

.BE Domain names

55940

.EU Domain names