Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
villagesclubs-pierreetvacances.eu 2025-03-10 00:00 Place bid
bbcosmeticexperts.nl 2025-03-15 00:00 Place bid
silicom.eu 2025-03-08 00:00 Place bid
tikvis.nl 2025-03-02 00:00 Place bid
dronecontainer.nl 2025-03-19 00:00 Place bid
deknapstefamilievannederland.nl 2025-03-05 00:00 Place bid
mamadesigns.nl 2025-03-22 00:00 Place bid
truckmarket.eu 2025-02-19 00:00 Place bid
hoopsportvisserijfietsveer.nl 2025-02-17 00:00 Place bid
begeleidwonenbrussel.be 2025-03-15 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

69254

.NL Domain names

11889

.BE Domain names

51089

.EU Domain names