Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
ww2insouthlimburg.nl 2026-08-11 00:00 Place bid
information-works.eu 2026-08-09 00:00 Place bid
alexandraweber.eu 2026-08-09 00:00 Place bid
powerpad.eu 2026-08-19 00:00 Place bid
clicheskate.eu 2026-07-27 00:00 Place bid
swissport.eu 2026-08-29 00:00 Place bid
sabray.nl 2026-08-24 00:00 Place bid
blessedagency.nl 2026-08-16 00:00 Place bid
carrosseriepolish-dsp.be 2026-08-26 00:00 Place bid
vanhaastrechtscheepstimmerwerk.nl 2026-08-11 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

58410

.NL Domain names

11224

.BE Domain names

39798

.EU Domain names