Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
akademiabi.eu 2026-07-19 00:00 Place bid
rapesexportal.nl 2026-08-09 00:00 Place bid
kuipstoel.nl 2026-07-17 00:00 Place bid
oceaneng.eu 2026-08-08 00:00 Place bid
webdesignchick.nl 2026-07-29 00:00 Place bid
samair.nl 2026-08-15 00:00 Place bid
vanhaastrechtscheepstimmerwerk.nl 2026-08-11 00:00 Place bid
socios.eu 2026-08-04 00:00 Place bid
stoykov.eu 2026-08-01 00:00 Place bid
ankeenanne-utrecht.nl 2026-07-15 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

57751

.NL Domain names

9826

.BE Domain names

34556

.EU Domain names