Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name	Auction ends at
khugo.nl	2025-03-19 00:00	Place bid
aandeoostdijk.nl	2025-02-23 00:00	Place bid
nvrmarkt.nl	2025-04-01 00:00	Place bid
freshthinking.eu	2025-03-09 00:00	Place bid
salinaluxuries.nl	2025-02-23 00:00	Place bid
theimpactproject.nl	2025-02-25 00:00	Place bid
claritysuccess.be	2025-02-27 00:00	Place bid
kochfamilie.nl	2025-02-26 00:00	Place bid
deknapstefamilievannederland.nl	2025-03-05 00:00	Place bid
renditen.eu	2025-03-20 00:00	Place bid

All domains that are quarantined