Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
watervijver.be 2025-03-13 00:00 Place bid
bhang.eu 2025-03-07 00:00 Place bid
bershop.nl 2025-03-06 00:00 Place bid
ifeng.eu 2025-03-19 00:00 Place bid
tombihn.nl 2025-03-12 00:00 Place bid
nitr0.nl 2025-03-14 00:00 Place bid
deknapstefamilievannederland.nl 2025-03-05 00:00 Place bid
clothesbyann.nl 2025-02-24 00:00 Place bid
xtrazz.nl 2025-02-26 00:00 Place bid
lerenmetmeta.nl 2025-03-11 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

67493

.NL Domain names

12643

.BE Domain names

54825

.EU Domain names