Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
kapelle-falaise.eu 2025-03-11 00:00 Place bid
sleepstyler.nl 2025-03-14 00:00 Place bid
olimaz.nl 2025-03-09 00:00 Place bid
csone.eu 2025-02-26 00:00 Place bid
drykicks.nl 2025-03-02 00:00 Place bid
yinyan.eu 2025-02-28 00:00 Place bid
hoeve-rijckevorsel.nl 2025-03-11 00:00 Place bid
deknapstefamilievannederland.nl 2025-03-05 00:00 Place bid
rooftopdolores.nl 2025-03-04 00:00 Place bid
sosdienstverlening.nl 2025-02-25 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

67732

.NL Domain names

12968

.BE Domain names

54950

.EU Domain names