Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
rideto.eu 2025-07-29 00:00 Place bid
stockfrog.nl 2025-08-03 00:00 Place bid
seoenseaspecialist.nl 2025-08-14 00:00 Place bid
restaurantplatinumlounge-utrecht.nl 2025-07-27 00:00 Place bid
petpros.eu 2025-08-09 00:00 Place bid
tastyfriedchickenamstelveen-amstelveen.nl 2025-08-05 00:00 Place bid
camelya.nl 2025-08-08 00:00 Place bid
blenoir.nl 2025-07-29 00:00 Place bid
intrai.nl 2025-07-23 00:00 Place bid
t-y.eu 2025-07-31 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

71561

.NL Domain names

14705

.BE Domain names

48196

.EU Domain names