Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
pc-store.nl 2025-08-01 00:00 Place bid
laurajeans.nl 2025-08-16 00:00 Place bid
eenvoudlaan6.nl 2025-08-11 00:00 Place bid
fanteam.be 2025-08-09 00:00 Place bid
we-it.nl 2025-07-20 00:00 Place bid
dewatervrienden.nl 2025-07-31 00:00 Place bid
motour.eu 2025-08-07 00:00 Place bid
zenwellnessandbeauty33center.eu 2025-07-27 00:00 Place bid
tastyfriedchickenamstelveen-amstelveen.nl 2025-08-05 00:00 Place bid
gvselectronics.be 2025-08-10 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

72933

.NL Domain names

9398

.BE Domain names

48467

.EU Domain names